(data stored in ACNUC1104 zone)

EMBL: AP008957.PE12

AP008957.PE12        Location/Qualifiers
FT   CDS             16859..17968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30720"
FT                   /db_xref="InterPro:IPR041638"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF2"
FT                   /protein_id="BAH30720.1"
FT                   /translation="MLHNDIPSHGEIAALAEVEGPTCITIVTPTEDAPQDHDKARIAFK
FT                   DQVRSALASVEDPAERKLFEAEYAELDDDDDFWRFQSRSLVTYATPERLVTFRLPNRLQ
FT                   ALETVSDRFHLKPLLRSVTFPQTAFVLALAEGSVRLIEIAADQPADEVRVQGMPKNAAD
FT                   HAGKSSINSRTEAGRLSGSDSRKLRVNQYARAVDHEVRGVLAGRDVPLILAAAEPIASV
FT                   YRSVNSYRHLVDKTVEGNPEALSTQEVADGSRPALDDFHAEQLAAVRDTFNVRTEQGRT
FT                   QTDVADVATAATYGQVDTVFIDIDSVVPGSLDPQTGALTTGESTNGSTYGVVDEIARRA
FT                   LLTGARVLAVRAEDIPGGGAVAAILRFAP"
     MLHNDIPSHG EIAALAEVEG PTCITIVTPT EDAPQDHDKA RIAFKDQVRS ALASVEDPAE        60
     RKLFEAEYAE LDDDDDFWRF QSRSLVTYAT PERLVTFRLP NRLQALETVS DRFHLKPLLR       120
     SVTFPQTAFV LALAEGSVRL IEIAADQPAD EVRVQGMPKN AADHAGKSSI NSRTEAGRLS       180
     GSDSRKLRVN QYARAVDHEV RGVLAGRDVP LILAAAEPIA SVYRSVNSYR HLVDKTVEGN       240
     PEALSTQEVA DGSRPALDDF HAEQLAAVRD TFNVRTEQGR TQTDVADVAT AATYGQVDTV       300
     FIDIDSVVPG SLDPQTGALT TGESTNGSTY GVVDEIARRA LLTGARVLAV RAEDIPGGGA       360
     VAAILRFAP                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page