(data stored in ACNUC1104 zone)

EMBL: AP008957.PE120

AP008957.PE120       Location/Qualifiers
FT   CDS             complement(137593..139155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01200"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30828"
FT                   /db_xref="GOA:C0ZLD8"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD8"
FT                   /protein_id="BAH30828.1"
FT                   /translation="MSTETDTGSAPTPAKKKFEFPGAVTMLAIVTVLVWVAALFIPAGR
FT                   FGVDVDGSPVPGSFETVTSPLSFWERIQQLILSPVNGLYGVQDSITGFVDTDNIGRLFG
FT                   SVGVVLFIMALGAFISVSFATRSLETAVSQLATKLSDKGWLLITVIMVLFSLLGSTMGF
FT                   SVETFGFYALLIPLMTALGYDRMVAATMIILGALVGNMASTVNPFSIGVASGEAGVSIG
FT                   DGIVLRVILWIVLTAVAVVFVLRYAAKVKKDPSKSLVGFDIEDDEDEEPAEPVDIDGKL
FT                   TGTQKLVLLITGLTFGLMIFSVIPWSSIFGATTGPAEYDAYHVTATEPYWFELNWWFPQ
FT                   LAMLFILAAVLVGIVAKMGEKKIVSLITRGAGDMVGPAIVILLARGVSVIMTNTETLDT
FT                   ILNAMEQLVSGASAGVFAILVMLVNIPLAFLIPSSSGHATLAMPLLAPLGDFAGVSRAL
FT                   VITAFQMGHGLMLMVAPTNVVVVGGLAMAKVGYDKFLRFVWPLLLINFVIVVVVIGAAA
FT                   VFE"
     MSTETDTGSA PTPAKKKFEF PGAVTMLAIV TVLVWVAALF IPAGRFGVDV DGSPVPGSFE        60
     TVTSPLSFWE RIQQLILSPV NGLYGVQDSI TGFVDTDNIG RLFGSVGVVL FIMALGAFIS       120
     VSFATRSLET AVSQLATKLS DKGWLLITVI MVLFSLLGST MGFSVETFGF YALLIPLMTA       180
     LGYDRMVAAT MIILGALVGN MASTVNPFSI GVASGEAGVS IGDGIVLRVI LWIVLTAVAV       240
     VFVLRYAAKV KKDPSKSLVG FDIEDDEDEE PAEPVDIDGK LTGTQKLVLL ITGLTFGLMI       300
     FSVIPWSSIF GATTGPAEYD AYHVTATEPY WFELNWWFPQ LAMLFILAAV LVGIVAKMGE       360
     KKIVSLITRG AGDMVGPAIV ILLARGVSVI MTNTETLDTI LNAMEQLVSG ASAGVFAILV       420
     MLVNIPLAFL IPSSSGHATL AMPLLAPLGD FAGVSRALVI TAFQMGHGLM LMVAPTNVVV       480
     VGGLAMAKVG YDKFLRFVWP LLLINFVIVV VVIGAAAVFE                             520
//

If you have problems or comments...

PBIL Back to PBIL home page