(data stored in ACNUC1104 zone)

EMBL: AP008957.PE121

AP008957.PE121       Location/Qualifiers
FT   CDS             complement(139152..140528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30829"
FT                   /db_xref="GOA:C0ZLD9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD9"
FT                   /protein_id="BAH30829.1"
FT                   /translation="MPEEFASPSYSTIKETVAGLMPALESELVELVRIPSIATEGFPSE
FT                   PLFEAHDLIVSLLEKAGVTKIEKLEITGKTAPVIIATVPGPEGAPTVLMYSHYDVVPAD
FT                   DVELWESPPFEPTKRDGAIYGRGTADSKANVIGMIGALRVFDGKPPVTVKLVIEGQEEF
FT                   GSPFDNYPPEAPELFAADAMVIADVGSVRPGSPTLTVALRGSAQVIVELTTLGADKHNG
FT                   LYGGAAPDARLALIRALASLHDDNGDVAVDGLLREPWTGSSYTEEEFRTLAEIRDGLPL
FT                   LGTGGIGERIWSGPAITVTGIDAPPVDGAVNAVASTARAVVNLRVHPRQPAADAQAALI
FT                   RHLEALRPFGLQLTVTAGETGDGFAAAEGGPAFDAALSALSQSWGEPAGLMAGGGSIPL
FT                   VMALDTAVPTAEKLLFGATDGYANIHGPNERVLLDELEKAVVAKALFFQEYAHTFEGKK
FT                   "
     MPEEFASPSY STIKETVAGL MPALESELVE LVRIPSIATE GFPSEPLFEA HDLIVSLLEK        60
     AGVTKIEKLE ITGKTAPVII ATVPGPEGAP TVLMYSHYDV VPADDVELWE SPPFEPTKRD       120
     GAIYGRGTAD SKANVIGMIG ALRVFDGKPP VTVKLVIEGQ EEFGSPFDNY PPEAPELFAA       180
     DAMVIADVGS VRPGSPTLTV ALRGSAQVIV ELTTLGADKH NGLYGGAAPD ARLALIRALA       240
     SLHDDNGDVA VDGLLREPWT GSSYTEEEFR TLAEIRDGLP LLGTGGIGER IWSGPAITVT       300
     GIDAPPVDGA VNAVASTARA VVNLRVHPRQ PAADAQAALI RHLEALRPFG LQLTVTAGET       360
     GDGFAAAEGG PAFDAALSAL SQSWGEPAGL MAGGGSIPLV MALDTAVPTA EKLLFGATDG       420
     YANIHGPNER VLLDELEKAV VAKALFFQEY AHTFEGKK                               458
//

If you have problems or comments...

PBIL Back to PBIL home page