(data stored in ACNUC1104 zone)

EMBL: AP008957.PE129

AP008957.PE129       Location/Qualifiers
FT   CDS             complement(151378..152292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01290"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30837"
FT                   /db_xref="GOA:C0ZLL0"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL0"
FT                   /protein_id="BAH30837.1"
FT                   /translation="MLFAVPTALLGVLIAWGLASPSGPESSSTVRVLAIGCGSLTLGIA
FT                   TLAWMGRSERRPATTPAIMWTQLTAAAAVWLVAEITLLVLNAAAADGAPVTSLTIGHFG
FT                   AFVSEVNVGRVGVAIIACAFAVVCYGIYGFTNPETVPVAPALVVSALALAARPITGHMA
FT                   QQSFGSILDAVHVLAAALWFGVLAALALAVPSRGAWAIWLPRYSALAWRCVLALVVTGI
FT                   VNAVVRLDSLSAFYDTAYGRVILAKIVAIAMLVALGWWWRRTWVVASAAHRMSSDGSLR
FT                   RAIGEVVFMAIAFGLAAALATTA"
     MLFAVPTALL GVLIAWGLAS PSGPESSSTV RVLAIGCGSL TLGIATLAWM GRSERRPATT        60
     PAIMWTQLTA AAAVWLVAEI TLLVLNAAAA DGAPVTSLTI GHFGAFVSEV NVGRVGVAII       120
     ACAFAVVCYG IYGFTNPETV PVAPALVVSA LALAARPITG HMAQQSFGSI LDAVHVLAAA       180
     LWFGVLAALA LAVPSRGAWA IWLPRYSALA WRCVLALVVT GIVNAVVRLD SLSAFYDTAY       240
     GRVILAKIVA IAMLVALGWW WRRTWVVASA AHRMSSDGSL RRAIGEVVFM AIAFGLAAAL       300
     ATTA                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page