(data stored in ACNUC1104 zone)

EMBL: AP008957.PE134

AP008957.PE134       Location/Qualifiers
FT   CDS             154835..156427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30842"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL5"
FT                   /protein_id="BAH30842.1"
FT                   /translation="MCSVNNPAPQLPIIDSGALTRCRHRVRLDGLFPGKSASEPVDTGV
FT                   KQRQDAAIAKRAEIAELVIGAAPERWVKINPDQSASAQARDTLAACEAGADRIWGAVLP
FT                   VERDTGRKGRCEMLVRDDEGGGYIPVIVVNHKVTDPGQGAITSGLLEWEPAVDPKRKVR
FT                   SQVRDQMRVAQVYRMLERRGLASPSLTAGAIGYNGDCVLVHDLSAILDDYDERFADRIA
FT                   VARGEVLTSPSQVSECKSCPWWTECKQELVRNRDVSLVAVGSRAELLRDVGCNTIDQLA
FT                   AWDGEPLEDWPHGNFDDAVVIAKAWLADAPLVRRFEKISVTRADIEIDVDMESYQEHGA
FT                   YLWGTLLNVGGFSMYRGFATWDPLPTRDEARSFAEFWGWLMAERAAAAASGKTFAAYCY
FT                   SRSAEDKWLLDSARRFAGEPGIPSKDEIREFIDSPQWVDIYQAVSDQFICPNGKGLKKI
FT                   APVAGFNWRDAEAGGEASMAWYREAVGYDGEPDETQRTRILQYNEDDVIATKVLREWMT
FT                   DRAEKEIPLASEL"
     MCSVNNPAPQ LPIIDSGALT RCRHRVRLDG LFPGKSASEP VDTGVKQRQD AAIAKRAEIA        60
     ELVIGAAPER WVKINPDQSA SAQARDTLAA CEAGADRIWG AVLPVERDTG RKGRCEMLVR       120
     DDEGGGYIPV IVVNHKVTDP GQGAITSGLL EWEPAVDPKR KVRSQVRDQM RVAQVYRMLE       180
     RRGLASPSLT AGAIGYNGDC VLVHDLSAIL DDYDERFADR IAVARGEVLT SPSQVSECKS       240
     CPWWTECKQE LVRNRDVSLV AVGSRAELLR DVGCNTIDQL AAWDGEPLED WPHGNFDDAV       300
     VIAKAWLADA PLVRRFEKIS VTRADIEIDV DMESYQEHGA YLWGTLLNVG GFSMYRGFAT       360
     WDPLPTRDEA RSFAEFWGWL MAERAAAAAS GKTFAAYCYS RSAEDKWLLD SARRFAGEPG       420
     IPSKDEIREF IDSPQWVDIY QAVSDQFICP NGKGLKKIAP VAGFNWRDAE AGGEASMAWY       480
     REAVGYDGEP DETQRTRILQ YNEDDVIATK VLREWMTDRA EKEIPLASEL                  530
//

If you have problems or comments...

PBIL Back to PBIL home page