(data stored in ACNUC1104 zone)

EMBL: AP008957.PE137

AP008957.PE137       Location/Qualifiers
FT   CDS             159875..160465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30845"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL8"
FT                   /protein_id="BAH30845.1"
FT                   /translation="MSKAPVRPAASVENFERLQRDPLFEDLAELIAEVLSYAFDAPAAV
FT                   EIEQWTISCLPSTNRSAERHRLFTLNIGPMEILSVECHLVGGKPIEHVMSVYVSSSALE
FT                   SRTGCSIEELDEKHDLVAIRRTELASADGDGTVIDCSLEDSDALEQFALLPVDVTTVRP
FT                   LAEHLVAKGKGPFRQYHNSGFAKYVLERSLDHG"
     MSKAPVRPAA SVENFERLQR DPLFEDLAEL IAEVLSYAFD APAAVEIEQW TISCLPSTNR        60
     SAERHRLFTL NIGPMEILSV ECHLVGGKPI EHVMSVYVSS SALESRTGCS IEELDEKHDL       120
     VAIRRTELAS ADGDGTVIDC SLEDSDALEQ FALLPVDVTT VRPLAEHLVA KGKGPFRQYH       180
     NSGFAKYVLE RSLDHG                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page