(data stored in ACNUC1104 zone)

EMBL: AP008957.PE138

AP008957.PE138       Location/Qualifiers
FT   CDS             160458..161108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30846"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL9"
FT                   /protein_id="BAH30846.1"
FT                   /translation="MVDQLPIRLPRVLRDGDDAGAVDVLQEYFTRPLRKTGYLRTGALW
FT                   DSWDPSGNRDRDANIFTAEDLVAVTLLSVQVPAQGAFFLLGENNAELNRLLADVGPDRD
FT                   LSNEPDPFTPESPVWRLETALREIHGVGRTMASKLIARKRPRLHPIYDDVIGRELGTKA
FT                   AHLEPVREALHDGELHVRLLDLRVRAGLDDAIPAIRVLDVLAWMQGKGYKPAL"
     MVDQLPIRLP RVLRDGDDAG AVDVLQEYFT RPLRKTGYLR TGALWDSWDP SGNRDRDANI        60
     FTAEDLVAVT LLSVQVPAQG AFFLLGENNA ELNRLLADVG PDRDLSNEPD PFTPESPVWR       120
     LETALREIHG VGRTMASKLI ARKRPRLHPI YDDVIGRELG TKAAHLEPVR EALHDGELHV       180
     RLLDLRVRAG LDDAIPAIRV LDVLAWMQGK GYKPAL                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page