(data stored in ACNUC1104 zone)

EMBL: AP008957.PE139

AP008957.PE139       Location/Qualifiers
FT   CDS             161120..162601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30847"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM0"
FT                   /protein_id="BAH30847.1"
FT                   /translation="MGRSSLECMFDNGSTGGVGAVVDDGRPVVDPLVLPDILFATAQSE
FT                   NMLAAQKVLGASMLSESRFNAELDVSGDVDKAWRIACNEIAVMLTCSRRTAEVHIEIGD
FT                   ALREFLPLTKAAFAAGELDYARVRKIVDGLTGAAPEAIAALERRVLASAHRLPPGQLER
FT                   DIERQLFAYDPDAAAERRRKMLEHRDVRTRADRHGLAQLQATLSANEAVEALGLINEAA
FT                   GSVCNHDPRNASTRRADALVALLHGENGLTCQCGSETCEAVSPASRSTAPSRRKPLLHI
FT                   VCDLATLLGLTSDPASIDGYGPIDPDFARELAADSTWQALFVDFRSQAAGNRPRRQHAP
FT                   TVLPLVTRRNHPSREPKGCGDRIRAMQRLVARAPDIVRRSDGHGAQPDPTPGALTYAPG
FT                   AALAALVRAVDGHCRFPGCSVPASRCQLDHITEFDPSDPRRGGWTIASNLQCLCRHHHQ
FT                   VKTYRLWTPVMLVDRAIHWTDKTSGLTTVTVPERR"
     MGRSSLECMF DNGSTGGVGA VVDDGRPVVD PLVLPDILFA TAQSENMLAA QKVLGASMLS        60
     ESRFNAELDV SGDVDKAWRI ACNEIAVMLT CSRRTAEVHI EIGDALREFL PLTKAAFAAG       120
     ELDYARVRKI VDGLTGAAPE AIAALERRVL ASAHRLPPGQ LERDIERQLF AYDPDAAAER       180
     RRKMLEHRDV RTRADRHGLA QLQATLSANE AVEALGLINE AAGSVCNHDP RNASTRRADA       240
     LVALLHGENG LTCQCGSETC EAVSPASRST APSRRKPLLH IVCDLATLLG LTSDPASIDG       300
     YGPIDPDFAR ELAADSTWQA LFVDFRSQAA GNRPRRQHAP TVLPLVTRRN HPSREPKGCG       360
     DRIRAMQRLV ARAPDIVRRS DGHGAQPDPT PGALTYAPGA ALAALVRAVD GHCRFPGCSV       420
     PASRCQLDHI TEFDPSDPRR GGWTIASNLQ CLCRHHHQVK TYRLWTPVML VDRAIHWTDK       480
     TSGLTTVTVP ERR                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page