(data stored in ACNUC1104 zone)

EMBL: AP008957.PE143

AP008957.PE143       Location/Qualifiers
FT   CDS             165146..165577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30851"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM4"
FT                   /protein_id="BAH30851.1"
FT                   /translation="MASVSVSAVLPASPEKTWDALSDLSRWEEWLTIHQGWKSELPTQV
FT                   ALGAKFTEVVSVMGMANKIEWTVEEVEVPKMVKIAGTGMAGVTVEFVLSVEADGAGSKA
FT                   TVDASFKGTMIVGPIGKAVAKNAKADLEASLAKFAELVG"
     MASVSVSAVL PASPEKTWDA LSDLSRWEEW LTIHQGWKSE LPTQVALGAK FTEVVSVMGM        60
     ANKIEWTVEE VEVPKMVKIA GTGMAGVTVE FVLSVEADGA GSKATVDASF KGTMIVGPIG       120
     KAVAKNAKAD LEASLAKFAE LVG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page