(data stored in ACNUC1104 zone)

EMBL: AP008957.PE144

AP008957.PE144       Location/Qualifiers
FT   CDS             165585..166460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30852"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM5"
FT                   /protein_id="BAH30852.1"
FT                   /translation="MTTPKTNAVEFDTSGLDVWTDPEHFEVTAERIAEYAAATNDPIER
FT                   HLKGEIAPPVFAVVPVFMSMAPAALSVAPVELLMKLVHGEQDFLFHRPIYPGDHLVARA
FT                   KPIGFEGRDNGSTVVIYVETKTDKGELVNEQWMTAFFRKVDAGPGLGEKAPEHRFDDAL
FT                   RAGSPAAVVNQHIDEDQTFRYSPASGDPMPIHLDEEIARMSGLPGIINHGLCTMAFTSW
FT                   GALTELAGGETERLRRLAVRFAKPVLPTQDIETVFYKSGSADGATSYSYETSAVGDLVI
FT                   KDGLAVIADK"
     MTTPKTNAVE FDTSGLDVWT DPEHFEVTAE RIAEYAAATN DPIERHLKGE IAPPVFAVVP        60
     VFMSMAPAAL SVAPVELLMK LVHGEQDFLF HRPIYPGDHL VARAKPIGFE GRDNGSTVVI       120
     YVETKTDKGE LVNEQWMTAF FRKVDAGPGL GEKAPEHRFD DALRAGSPAA VVNQHIDEDQ       180
     TFRYSPASGD PMPIHLDEEI ARMSGLPGII NHGLCTMAFT SWGALTELAG GETERLRRLA       240
     VRFAKPVLPT QDIETVFYKS GSADGATSYS YETSAVGDLV IKDGLAVIAD K                291
//

If you have problems or comments...

PBIL Back to PBIL home page