(data stored in ACNUC1104 zone)

EMBL: AP008957.PE16

AP008957.PE16        Location/Qualifiers
FT   CDS             complement(21157..21690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30724"
FT                   /db_xref="GOA:C0ZLF6"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF6"
FT                   /protein_id="BAH30724.1"
FT                   /translation="MPLPTFSRMPPRKTLPVPASLLWHSEVMTRVTESLSTQLPDTFDH
FT                   ARARVEDTFDETAAYLEETAARIKESEAADNARRIAAVVATSVARGAGQVGLFLGRQGK
FT                   VLAKKGVERAKAIPTKSAERTEKPRGRKRVAVFVIAGVAVIGGAVFFKSRRREHPPVAS
FT                   APPRLEENSAEKTA"
     MPLPTFSRMP PRKTLPVPAS LLWHSEVMTR VTESLSTQLP DTFDHARARV EDTFDETAAY        60
     LEETAARIKE SEAADNARRI AAVVATSVAR GAGQVGLFLG RQGKVLAKKG VERAKAIPTK       120
     SAERTEKPRG RKRVAVFVIA GVAVIGGAVF FKSRRREHPP VASAPPRLEE NSAEKTA          177
//

If you have problems or comments...

PBIL Back to PBIL home page