(data stored in ACNUC1104 zone)

EMBL: AP008957.PE161

AP008957.PE161       Location/Qualifiers
FT   CDS             184242..184814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01610"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30869"
FT                   /db_xref="GOA:C0ZLP2"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP2"
FT                   /protein_id="BAH30869.1"
FT                   /translation="MVTQNPFVQYGKEIWWMILIRGIFGVIFGIIALVWPGITVVALVF
FT                   LFGIYSIVDGLITLVRAIRDREHLSSWGWWVFTGVVSVGAGIVALVWPGITALVLLYII
FT                   AFYAIMFGIFGIVGAFKMKALPGSSWGWLLAASVLAVIFGIILLIAPGEGIISLIWLLG
FT                   WYAILFGLFMTVGAFQIRSRAKEAGVL"
     MVTQNPFVQY GKEIWWMILI RGIFGVIFGI IALVWPGITV VALVFLFGIY SIVDGLITLV        60
     RAIRDREHLS SWGWWVFTGV VSVGAGIVAL VWPGITALVL LYIIAFYAIM FGIFGIVGAF       120
     KMKALPGSSW GWLLAASVLA VIFGIILLIA PGEGIISLIW LLGWYAILFG LFMTVGAFQI       180
     RSRAKEAGVL                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page