(data stored in ACNUC1104 zone)

EMBL: AP008957.PE163

AP008957.PE163       Location/Qualifiers
FT   CDS             185997..187343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30871"
FT                   /db_xref="GOA:C0ZLP4"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP4"
FT                   /protein_id="BAH30871.1"
FT                   /translation="MSAENTTENSHRQPSRLGRRLAVGGVAAIVAAAVAGIGFVIFAGG
FT                   ADSSNTVAIVNADAGTTLDGKELRAGDTLVDTLGKNEDFDFQVVDNPGGNYFATLTVPE
FT                   DFSETVASMFGTDPRQASVELAVNGSDSEKSAELTRAVSAQVGADGIKGLLAQTSAARR
FT                   SIDQNLTTAQILVAGTNEAGKSIDQVKAGAGTLLPYLETARSGALELMSVADQVSGVVD
FT                   QASGSAEELATRADSLGLTLGEASSSSAELKTRIDTLQTALNGLPIPPDVTAQLAGVSS
FT                   DLGALNAQLGTVPALLGGSVGPDTELGDLVRTAVGQLQGASDQLSSAAGQLNDGLIPIA
FT                   DQAPQMLGDVTDQITQGFTTLQGIAKSLVTGLDGAKSGIPAMTTPQQVQLTSVLSDPVA
FT                   VNQTSANSGDSGTRTLALVFGATTVLLGGALLTRTAAPLVRRRRSQEEL"
     MSAENTTENS HRQPSRLGRR LAVGGVAAIV AAAVAGIGFV IFAGGADSSN TVAIVNADAG        60
     TTLDGKELRA GDTLVDTLGK NEDFDFQVVD NPGGNYFATL TVPEDFSETV ASMFGTDPRQ       120
     ASVELAVNGS DSEKSAELTR AVSAQVGADG IKGLLAQTSA ARRSIDQNLT TAQILVAGTN       180
     EAGKSIDQVK AGAGTLLPYL ETARSGALEL MSVADQVSGV VDQASGSAEE LATRADSLGL       240
     TLGEASSSSA ELKTRIDTLQ TALNGLPIPP DVTAQLAGVS SDLGALNAQL GTVPALLGGS       300
     VGPDTELGDL VRTAVGQLQG ASDQLSSAAG QLNDGLIPIA DQAPQMLGDV TDQITQGFTT       360
     LQGIAKSLVT GLDGAKSGIP AMTTPQQVQL TSVLSDPVAV NQTSANSGDS GTRTLALVFG       420
     ATTVLLGGAL LTRTAAPLVR RRRSQEEL                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page