(data stored in ACNUC1104 zone)

EMBL: AP008957.PE172

AP008957.PE172       Location/Qualifiers
FT   CDS             195627..196571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30880"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ3"
FT                   /protein_id="BAH30880.1"
FT                   /translation="MAGQRVDFALVAKKSKRNSGPKQGSARAEKLAARQAEREAAAGAV
FT                   NRPFEGLAAECDLVALREFVPSATAPLPVIGSDRPVTLATVLPGAVAALVRDEGETATG
FT                   FVGVQVQAHSADLGADLAASVNWIKDAAPGDALSAANPDSETPAVTEVVDPSALLDITV
FT                   HQNFNWWIPEGVETDPEVAATVQHANSAIMPSARLEGDGLVAAWWVDAGEKAHLRWVRP
FT                   ESEDDLMLALARVHATGGLHLGEGSRYAGSFRTHGLLVPVFDLDREKHANEWVAATVEL
FT                   GERLAEALAVDAPLNSAELRSRDGLRGRQVTLR"
     MAGQRVDFAL VAKKSKRNSG PKQGSARAEK LAARQAEREA AAGAVNRPFE GLAAECDLVA        60
     LREFVPSATA PLPVIGSDRP VTLATVLPGA VAALVRDEGE TATGFVGVQV QAHSADLGAD       120
     LAASVNWIKD AAPGDALSAA NPDSETPAVT EVVDPSALLD ITVHQNFNWW IPEGVETDPE       180
     VAATVQHANS AIMPSARLEG DGLVAAWWVD AGEKAHLRWV RPESEDDLML ALARVHATGG       240
     LHLGEGSRYA GSFRTHGLLV PVFDLDREKH ANEWVAATVE LGERLAEALA VDAPLNSAEL       300
     RSRDGLRGRQ VTLR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page