(data stored in ACNUC1104 zone)

EMBL: AP008957.PE175

AP008957.PE175       Location/Qualifiers
FT   CDS             complement(198140..199066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01750"
FT                   /product="probable cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30883"
FT                   /db_xref="GOA:C0ZLQ6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ6"
FT                   /protein_id="BAH30883.1"
FT                   /translation="MSHGHGHGISPAEAATSNSGKHVNKLWIAAGLGLVTFVLQVTVGF
FT                   FTSSLALLSDSAHVFTDIFGIFMALAAILVAQRAARRPDRTFGMYRTEVFAALANAILL
FT                   FAVAGWVLYEAASRFSDPPEVPGLPVAIVAVVGLAMNVIAFLMLRSGAKESINIRGAYL
FT                   EVMADMIGSIGVLVSGLVTLAFGWRYADPVIGVAIGLFVLPRAFNLGRHAVRILLQQAP
FT                   DRIDVTSILEKINTLPGVVDAHDLHVWTLTSGMEVASVHVTAASDADPTTVLAATQTLL
FT                   AEVFELEHATVQVELQGSDGKCTELAW"
     MSHGHGHGIS PAEAATSNSG KHVNKLWIAA GLGLVTFVLQ VTVGFFTSSL ALLSDSAHVF        60
     TDIFGIFMAL AAILVAQRAA RRPDRTFGMY RTEVFAALAN AILLFAVAGW VLYEAASRFS       120
     DPPEVPGLPV AIVAVVGLAM NVIAFLMLRS GAKESINIRG AYLEVMADMI GSIGVLVSGL       180
     VTLAFGWRYA DPVIGVAIGL FVLPRAFNLG RHAVRILLQQ APDRIDVTSI LEKINTLPGV       240
     VDAHDLHVWT LTSGMEVASV HVTAASDADP TTVLAATQTL LAEVFELEHA TVQVELQGSD       300
     GKCTELAW                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page