(data stored in ACNUC1104 zone)

EMBL: AP008957.PE178

AP008957.PE178       Location/Qualifiers
FT   CDS             200260..201207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01780"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30886"
FT                   /db_xref="GOA:C0ZLQ9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ9"
FT                   /protein_id="BAH30886.1"
FT                   /translation="MTLALPMLLGAVFVGFLVPRALRAVSSTLSPTVLLAAWLGSMASA
FT                   LYLALSAVLVLVWPSHAPVEGLVDGIARCFSAFAHGTSSWVGELITGTAVGVVGLIAVR
FT                   IVLAGRKQAREHARVREFHRDVLSIVARRDNSESDVLWLDHPLPMAYSVAGKPGFVVAT
FT                   QGLSSALTGGERDAVLAHERAHLSGGHHRIVGACEVLAAVLPGVPLFAAAPAAVGAIVE
FT                   LSADRHAARVTSPAAVRSALAVVSKSPLPQPDWSLGDRGGATAVRLRSLVDGDVASPRR
FT                   LTCAVAACVPAAITTAVAAAVTVAVSAGICAVLT"
     MTLALPMLLG AVFVGFLVPR ALRAVSSTLS PTVLLAAWLG SMASALYLAL SAVLVLVWPS        60
     HAPVEGLVDG IARCFSAFAH GTSSWVGELI TGTAVGVVGL IAVRIVLAGR KQAREHARVR       120
     EFHRDVLSIV ARRDNSESDV LWLDHPLPMA YSVAGKPGFV VATQGLSSAL TGGERDAVLA       180
     HERAHLSGGH HRIVGACEVL AAVLPGVPLF AAAPAAVGAI VELSADRHAA RVTSPAAVRS       240
     ALAVVSKSPL PQPDWSLGDR GGATAVRLRS LVDGDVASPR RLTCAVAACV PAAITTAVAA       300
     AVTVAVSAGI CAVLT                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page