(data stored in ACNUC1104 zone)

EMBL: AP008957.PE182

AP008957.PE182       Location/Qualifiers
FT   CDS             complement(203515..203985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR3"
FT                   /protein_id="BAH30890.1"
FT                   /translation="MNTAHRRFRTAAVIAASAGAALLATSCSGTFDKFDESKAYKKTET
FT                   FSFAQASNGIDTLPSWVPAGATGIDEVIRTTGNERILRMTANITEIDHNSCIARPTVET
FT                   RPASLSAQWWPTGVEKGSSFQCGDWYVGEKDSFVYGYRPETLDFIIDQLDNK"
     MNTAHRRFRT AAVIAASAGA ALLATSCSGT FDKFDESKAY KKTETFSFAQ ASNGIDTLPS        60
     WVPAGATGID EVIRTTGNER ILRMTANITE IDHNSCIARP TVETRPASLS AQWWPTGVEK       120
     GSSFQCGDWY VGEKDSFVYG YRPETLDFII DQLDNK                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page