(data stored in ACNUC1104 zone)

EMBL: AP008957.PE183

AP008957.PE183       Location/Qualifiers
FT   CDS             complement(204085..204996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01830"
FT                   /product="putative LytR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30891"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR4"
FT                   /protein_id="BAH30891.1"
FT                   /translation="MLVLLLALAGAVYYVDSSLNRIDALPDYAGRVADTPGTNWLIVGS
FT                   DSREGLTPEQEQALATGGDTGPKRTDTVILVHVPKSGKTTMVSIPRDSYVPIPGYGSDK
FT                   INAAFAFGGAPLLVQTVEEATGLRIDHYAEIGFSGFAGIVDAVGGVNVCLTQAIDDPLA
FT                   GINLPAGCQDLKGSDALGFVRTRATALADLDRMNNQRQFMSALLSKATSPSTFLNPFRL
FT                   WPLVSDTAKSLQVDEGDHIWNLASLAWALRGGMTTTTVPVAGFEDVDGSGNVLLWDKAR
FT                   ASQFFDALANDQQIPQDLITTG"
     MLVLLLALAG AVYYVDSSLN RIDALPDYAG RVADTPGTNW LIVGSDSREG LTPEQEQALA        60
     TGGDTGPKRT DTVILVHVPK SGKTTMVSIP RDSYVPIPGY GSDKINAAFA FGGAPLLVQT       120
     VEEATGLRID HYAEIGFSGF AGIVDAVGGV NVCLTQAIDD PLAGINLPAG CQDLKGSDAL       180
     GFVRTRATAL ADLDRMNNQR QFMSALLSKA TSPSTFLNPF RLWPLVSDTA KSLQVDEGDH       240
     IWNLASLAWA LRGGMTTTTV PVAGFEDVDG SGNVLLWDKA RASQFFDALA NDQQIPQDLI       300
     TTG                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page