(data stored in ACNUC1104 zone)

EMBL: AP008957.PE189

AP008957.PE189       Location/Qualifiers
FT   CDS             complement(209479..211581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01890"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30897"
FT                   /db_xref="GOA:C0ZLS0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS0"
FT                   /protein_id="BAH30897.1"
FT                   /translation="MQFSRQPSSPGEQGSVATIDRPNEERATTPHRQDLNGLRGLAIGL
FT                   VVVFHVWFGQVSGGVDVFLVLSGYFFVGSLVRRAEAGGSLNPVPALRRVFLRLFPLIAV
FT                   VSILTALGTALLLPRTRWADLGDQLIAVLGFFQNWQLASTASDYLAADGSVTPLQHLWS
FT                   MAVQGQFYLLAIALVSVIAYVASRVNPNYFRPSLAVTLLVLTAGSFLYALAKSSRHQAW
FT                   AYYDSGARLWELALGGLLAVLMTSTRSRQIASLPFSVRATIGWAGLSSILLCGIVLDGA
FT                   QQFPGPWALVPVLATLALILSGVGDDTPWTSKTLAHPALTWLGSFAFALYLIHWPILVF
FT                   ALVITGRPEAGLLGGALIIALSVAGALALRRLVEVPVERGGRSRRYTVLACVVTAAAVL
FT                   AASVAWQSYASSQTTGQRAVDTLDLPTHPGALALTDGAEVPKASMVPSIFDAPLDLPAS
FT                   TLDGCIADFLERDVVHCTYGDADADRTIALAGGSHSEHWLTALDELGKSHGFRVDTYLK
FT                   MGCPLTVDSMQTLSDNDYPDCVDWSRGVLTELADASPDFVFTTATRPSSDGPGDVTPES
FT                   YVHVWQELERDGIDVLAIRDTPWLHHDGVAYRAIDCLATTTSPDHCAMPRSEMLSDVNP
FT                   APSAIADLTNVRLLDLSDGVCGPELCRVVEGNVLVYHDSHHLTASYVSTLSAELGRQLS
FT                   VQTGWW"
     MQFSRQPSSP GEQGSVATID RPNEERATTP HRQDLNGLRG LAIGLVVVFH VWFGQVSGGV        60
     DVFLVLSGYF FVGSLVRRAE AGGSLNPVPA LRRVFLRLFP LIAVVSILTA LGTALLLPRT       120
     RWADLGDQLI AVLGFFQNWQ LASTASDYLA ADGSVTPLQH LWSMAVQGQF YLLAIALVSV       180
     IAYVASRVNP NYFRPSLAVT LLVLTAGSFL YALAKSSRHQ AWAYYDSGAR LWELALGGLL       240
     AVLMTSTRSR QIASLPFSVR ATIGWAGLSS ILLCGIVLDG AQQFPGPWAL VPVLATLALI       300
     LSGVGDDTPW TSKTLAHPAL TWLGSFAFAL YLIHWPILVF ALVITGRPEA GLLGGALIIA       360
     LSVAGALALR RLVEVPVERG GRSRRYTVLA CVVTAAAVLA ASVAWQSYAS SQTTGQRAVD       420
     TLDLPTHPGA LALTDGAEVP KASMVPSIFD APLDLPASTL DGCIADFLER DVVHCTYGDA       480
     DADRTIALAG GSHSEHWLTA LDELGKSHGF RVDTYLKMGC PLTVDSMQTL SDNDYPDCVD       540
     WSRGVLTELA DASPDFVFTT ATRPSSDGPG DVTPESYVHV WQELERDGID VLAIRDTPWL       600
     HHDGVAYRAI DCLATTTSPD HCAMPRSEML SDVNPAPSAI ADLTNVRLLD LSDGVCGPEL       660
     CRVVEGNVLV YHDSHHLTAS YVSTLSAELG RQLSVQTGWW                             700
//

If you have problems or comments...

PBIL Back to PBIL home page