(data stored in ACNUC1104 zone)

EMBL: AP008957.PE195

AP008957.PE195       Location/Qualifiers
FT   CDS             215653..216120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30903"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS6"
FT                   /protein_id="BAH30903.1"
FT                   /translation="MPVAEAISNLHYKTHKRVCEYFVVMSENTPLDPEAVELAGRLFDM
FT                   ARTGDAAGLASYVDAGVPVNLTNESGDTLVMLAAYHGHADAVVALIERGADVNRPNDKN
FT                   QTPLAGAVFKGEDAVVKALVSGGADPKGGHPTAVDAARMFGREDYLSLLES"
     MPVAEAISNL HYKTHKRVCE YFVVMSENTP LDPEAVELAG RLFDMARTGD AAGLASYVDA        60
     GVPVNLTNES GDTLVMLAAY HGHADAVVAL IERGADVNRP NDKNQTPLAG AVFKGEDAVV       120
     KALVSGGADP KGGHPTAVDA ARMFGREDYL SLLES                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page