(data stored in ACNUC1104 zone)

EMBL: AP008957.PE205

AP008957.PE205       Location/Qualifiers
FT   CDS             230522..231985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30913"
FT                   /db_xref="GOA:C0ZLT6"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT6"
FT                   /protein_id="BAH30913.1"
FT                   /translation="MRVSILGLVPALALGVAIGGFTQIRADEPSILHAVAADTQFTLSG
FT                   HGNGHGRGMGQWGAYGYAKNDGWSGERILSHYYGGTVLDSLPPAQMSVRLTAQDNSTLD
FT                   VYSDAGLVVNGQRTAPGEAAHLTALPGGGAQVVVTSGCGGGVVWEAVTEHPWVDPVDLG
FT                   PDRPADQFLKLCNNDAPYRGALGVVLDNGSARTVNLLDMEDYLLGVVPVEAKAEWADSG
FT                   GAEALRAQAVAARSYAATEHRSSYADTCDTQDCQVYGGAGKEDPRTTEAVRSTAGAVLS
FT                   RDGKIVATEFSSSTGGYSSGGEFPAVEDLGDALSPNHDWTVNLTAGEIADAFDVGELQS
FT                   LKILSRNGFGTDGGRVTAVEVVGTDATVGATGMQFRQKLGLKSDWFTVGDGAGVVVAPD
FT                   SESTVPESNSPSDDPSGTVTETQIEKKYRELGGESGSLGAPAGPEMQLPSEAGTFRVYE
FT                   NGTIIWTKVLGAQVVDANVLREWIPTGGS"
     MRVSILGLVP ALALGVAIGG FTQIRADEPS ILHAVAADTQ FTLSGHGNGH GRGMGQWGAY        60
     GYAKNDGWSG ERILSHYYGG TVLDSLPPAQ MSVRLTAQDN STLDVYSDAG LVVNGQRTAP       120
     GEAAHLTALP GGGAQVVVTS GCGGGVVWEA VTEHPWVDPV DLGPDRPADQ FLKLCNNDAP       180
     YRGALGVVLD NGSARTVNLL DMEDYLLGVV PVEAKAEWAD SGGAEALRAQ AVAARSYAAT       240
     EHRSSYADTC DTQDCQVYGG AGKEDPRTTE AVRSTAGAVL SRDGKIVATE FSSSTGGYSS       300
     GGEFPAVEDL GDALSPNHDW TVNLTAGEIA DAFDVGELQS LKILSRNGFG TDGGRVTAVE       360
     VVGTDATVGA TGMQFRQKLG LKSDWFTVGD GAGVVVAPDS ESTVPESNSP SDDPSGTVTE       420
     TQIEKKYREL GGESGSLGAP AGPEMQLPSE AGTFRVYENG TIIWTKVLGA QVVDANVLRE       480
     WIPTGGS                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page