(data stored in ACNUC1104 zone)

EMBL: AP008957.PE224

AP008957.PE224       Location/Qualifiers
FT   CDS             261034..261966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02240"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30932"
FT                   /db_xref="GOA:C0ZLV5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV5"
FT                   /protein_id="BAH30932.1"
FT                   /translation="MTAQTPTPTRTPRGRIDPRLLVVGGAAAISISSLLIKLADVGPST
FT                   AVFFRCFLALPPLLWLAWREFRRVGKPSRRAVVLQVLGGLLLGLDFALWSQSILMIGAG
FT                   MASVVVNVQVIVVPALSWLVFGNRVPMRFVFALPFMFTGIALAGGVFGGGGTGDELLWG
FT                   TALSLVSGIAYGGYIFVVGRTGEADRAASQVLISTTSAGIAGSVIGSLWGRIDFVPGWE
FT                   AFGWLAALALVGQVFGWMLMGHSLPRLPAEVGATLLLMQPVLAVLLAVVLLGERPGVGQ
FT                   LLGCVVVVGAVSAVSIRRTRAVTRVGSAG"
     MTAQTPTPTR TPRGRIDPRL LVVGGAAAIS ISSLLIKLAD VGPSTAVFFR CFLALPPLLW        60
     LAWREFRRVG KPSRRAVVLQ VLGGLLLGLD FALWSQSILM IGAGMASVVV NVQVIVVPAL       120
     SWLVFGNRVP MRFVFALPFM FTGIALAGGV FGGGGTGDEL LWGTALSLVS GIAYGGYIFV       180
     VGRTGEADRA ASQVLISTTS AGIAGSVIGS LWGRIDFVPG WEAFGWLAAL ALVGQVFGWM       240
     LMGHSLPRLP AEVGATLLLM QPVLAVLLAV VLLGERPGVG QLLGCVVVVG AVSAVSIRRT       300
     RAVTRVGSAG                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page