(data stored in ACNUC1104 zone)

EMBL: AP008957.PE243

AP008957.PE243       Location/Qualifiers
FT   CDS             284543..286090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02430"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30951"
FT                   /db_xref="GOA:C0ZLX4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX4"
FT                   /protein_id="BAH30951.1"
FT                   /translation="MNADMMNDEPMAPGLHEQAGYADLILSALRRRPDHIAFRFTDRNG
FT                   DRAELTYRQTAEQIERIAGVLSSLALPDGGGVALLAGPCPEAFTVMAAACLAGVRYTAL
FT                   HPLATEENDRMVLKDSGTDLLLVADGQFQTRAEAAQTRVMSLSALESACELATAGTGSD
FT                   FGGQGRALYLFYTGGTTGEPKGVMLRDRSLVANAWACTTWEWPADTTMLLTTPMSHAAG
FT                   LLVAPGLQRGASFELHRSFDPDRVVDAIENDGVTATFVVPTMLYALLDHPRLSDANLSG
FT                   LNWMLYGAAPIDPTRLAQAGAVFGPILSQHYGQAEAPNALTVLDTREHTDDPAVLGSCG
FT                   RAMPGVEVVLFDEQGNETATGVPGELCVRGPLVMDGYWNKPEQTAAALANGWLHTGDVA
FT                   RIDETGLISIVDRIKDTIISGGFNVYPREVEDSLGHHPAVAACAVFGVPDPQWGEAVTA
FT                   AVVLKTGWSVTPEQLVAHVRSHKGPIWAPKEISILEALPLTALGKVDKKALRGASQT"
     MNADMMNDEP MAPGLHEQAG YADLILSALR RRPDHIAFRF TDRNGDRAEL TYRQTAEQIE        60
     RIAGVLSSLA LPDGGGVALL AGPCPEAFTV MAAACLAGVR YTALHPLATE ENDRMVLKDS       120
     GTDLLLVADG QFQTRAEAAQ TRVMSLSALE SACELATAGT GSDFGGQGRA LYLFYTGGTT       180
     GEPKGVMLRD RSLVANAWAC TTWEWPADTT MLLTTPMSHA AGLLVAPGLQ RGASFELHRS       240
     FDPDRVVDAI ENDGVTATFV VPTMLYALLD HPRLSDANLS GLNWMLYGAA PIDPTRLAQA       300
     GAVFGPILSQ HYGQAEAPNA LTVLDTREHT DDPAVLGSCG RAMPGVEVVL FDEQGNETAT       360
     GVPGELCVRG PLVMDGYWNK PEQTAAALAN GWLHTGDVAR IDETGLISIV DRIKDTIISG       420
     GFNVYPREVE DSLGHHPAVA ACAVFGVPDP QWGEAVTAAV VLKTGWSVTP EQLVAHVRSH       480
     KGPIWAPKEI SILEALPLTA LGKVDKKALR GASQT                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page