(data stored in ACNUC1104 zone)

EMBL: AP008957.PE260

AP008957.PE260       Location/Qualifiers
FT   CDS             complement(302774..303646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02600"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30968"
FT                   /db_xref="GOA:C0ZLZ1"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ1"
FT                   /protein_id="BAH30968.1"
FT                   /translation="MSASAIESETPDAPAPVSDSQTFRRAFKDLRDGLNQRELWLSLGW
FT                   QDIKQRYRRSVIGPFWITIATGVQATAIGILYAALLDMPLQEFLPYVTVGLIVWNLINA
FT                   SIIEGSEVFVANEGLIKQLPSALSVHIYRLVWRQMLFFAHNLLIYVIMVIAFGVWRNLS
FT                   WASLAAIPALGLIVLNALWVSIVFGIFATRYRDIAPILSSLTLLLFVLTPIMWTTQSLE
FT                   AQGGAVRDRAKIAELNPLFHYLDIVRAPMIGQPQELYHWYIVITITVVGWAVALLALRK
FT                   YRARVPYWV"
     MSASAIESET PDAPAPVSDS QTFRRAFKDL RDGLNQRELW LSLGWQDIKQ RYRRSVIGPF        60
     WITIATGVQA TAIGILYAAL LDMPLQEFLP YVTVGLIVWN LINASIIEGS EVFVANEGLI       120
     KQLPSALSVH IYRLVWRQML FFAHNLLIYV IMVIAFGVWR NLSWASLAAI PALGLIVLNA       180
     LWVSIVFGIF ATRYRDIAPI LSSLTLLLFV LTPIMWTTQS LEAQGGAVRD RAKIAELNPL       240
     FHYLDIVRAP MIGQPQELYH WYIVITITVV GWAVALLALR KYRARVPYWV                  290
//

If you have problems or comments...

PBIL Back to PBIL home page