(data stored in ACNUC1104 zone)

EMBL: AP008957.PE261

AP008957.PE261       Location/Qualifiers
FT   CDS             complement(303711..304280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30969"
FT                   /db_xref="GOA:C0ZLZ2"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ2"
FT                   /protein_id="BAH30969.1"
FT                   /translation="MTNPDKEQVLVIGPDGRPVAMPAAEAEAATSGTTEAAETEAESVA
FT                   EMVEQPAKVMRIGTMIKQLLEEVRAAPLDDASRKRLKDIHTSSIRELEQGLAPELREEL
FT                   ERLSLPFTDDSIPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQMRQGAL
FT                   PPGMSIGAPHSPAHPDQQSPGTGQYL"
     MTNPDKEQVL VIGPDGRPVA MPAAEAEAAT SGTTEAAETE AESVAEMVEQ PAKVMRIGTM        60
     IKQLLEEVRA APLDDASRKR LKDIHTSSIR ELEQGLAPEL REELERLSLP FTDDSIPSDA       120
     ELRIAQAQLV GWLEGLFHGI QTALFAQQMA ARAQLEQMRQ GALPPGMSIG APHSPAHPDQ       180
     QSPGTGQYL                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page