(data stored in ACNUC1104 zone)

EMBL: AP008957.PE262

AP008957.PE262       Location/Qualifiers
FT   CDS             304413..305615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30970"
FT                   /db_xref="GOA:C0ZLZ3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ3"
FT                   /protein_id="BAH30970.1"
FT                   /translation="MAYDVARVRGLIPSLGDGWIHLDPQAGMQIPDAVSRTVSTAFRAS
FT                   ASSSSGRHVSNRRSAAILESARTAVADLVGGDPAGVVLGSDRAVLLAWLAESLSSRLGL
FT                   GTGLVLSRLDEEANVAPWLRVASRYGAQVRWAEVEIETCELPSWQFNDLITSTTRLVAL
FT                   TAASPVVGSAPNVRAAADRLHEFGGLMVVDAVGAAPYAHVDMADLGADIVAVSAPSWGG
FT                   PQVGALVFRDPGLLDRIPAVSLNPYARGAERLEVGGHQFALLSGLTSSIDFLAGLDESA
FT                   TGTRRERLETSISSLQDYQDGLFDHLMRSLAALPNVMVIGGAPTRVPTLSFTLEGMAAD
FT                   KVAAHLADKRIATVSGTHGGSRLLDALGVNDEGGAVTVGLAPYTTRYEINQLVAELGAL
FT                   G"
     MAYDVARVRG LIPSLGDGWI HLDPQAGMQI PDAVSRTVST AFRASASSSS GRHVSNRRSA        60
     AILESARTAV ADLVGGDPAG VVLGSDRAVL LAWLAESLSS RLGLGTGLVL SRLDEEANVA       120
     PWLRVASRYG AQVRWAEVEI ETCELPSWQF NDLITSTTRL VALTAASPVV GSAPNVRAAA       180
     DRLHEFGGLM VVDAVGAAPY AHVDMADLGA DIVAVSAPSW GGPQVGALVF RDPGLLDRIP       240
     AVSLNPYARG AERLEVGGHQ FALLSGLTSS IDFLAGLDES ATGTRRERLE TSISSLQDYQ       300
     DGLFDHLMRS LAALPNVMVI GGAPTRVPTL SFTLEGMAAD KVAAHLADKR IATVSGTHGG       360
     SRLLDALGVN DEGGAVTVGL APYTTRYEIN QLVAELGALG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page