(data stored in ACNUC1104 zone)

EMBL: AP008957.PE266

AP008957.PE266       Location/Qualifiers
FT   CDS             309250..309933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02660"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30974"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ7"
FT                   /protein_id="BAH30974.1"
FT                   /translation="MATELKARTSRRRSRAAVGLAACAVAALSSGVVFAGSASATPTAL
FT                   SDKFASTVTDDGWSLDLAATKLSANPVPNLATTAFTREGFVSAKVTGTIGGAGDSAVKT
FT                   GYVEQGLQIGCQIDVSSGLGLGLGFSLGPSVGVSISGVPSANVGVNASVNPSIQSTIAP
FT                   GTITTIPLGKKDLESSKASITAENVHVKVDACMGPVTIRSYAQLSVSTATSDNTLFVYS
FT                   DPTWL"
     MATELKARTS RRRSRAAVGL AACAVAALSS GVVFAGSASA TPTALSDKFA STVTDDGWSL        60
     DLAATKLSAN PVPNLATTAF TREGFVSAKV TGTIGGAGDS AVKTGYVEQG LQIGCQIDVS       120
     SGLGLGLGFS LGPSVGVSIS GVPSANVGVN ASVNPSIQST IAPGTITTIP LGKKDLESSK       180
     ASITAENVHV KVDACMGPVT IRSYAQLSVS TATSDNTLFV YSDPTWL                     227
//

If you have problems or comments...

PBIL Back to PBIL home page