(data stored in ACNUC1104 zone)

EMBL: AP008957.PE269

AP008957.PE269       Location/Qualifiers
FT   CDS             310881..313247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30977"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM00"
FT                   /protein_id="BAH30977.1"
FT                   /translation="MKSVLKLRRSIAGALAAGALLTGVAGVIGAGIALTAGPATAGPAE
FT                   DCAAVRARDHQIYLNLIASLPPGAPVPPEYINPCLSAPTTTPTAAPTTTVGLPGAQAPG
FT                   GGPNVGANAPTNFPAYNGTPIVPVPGAALPGQPNTPTPSGIENPAGVPVPTTTSGPAPT
FT                   TPQPAGSTAPTAVPDRGPGPVPSGTPNSAPGQSESNPTVTPSGLDKGDGRDRYLELVLV
FT                   GAAAFTAGGIGVRGRRSPFGPRIPLGGRTPESILSQTVGTLASPLMQYVKGGQSKITVT
FT                   EPGGGRRTFFLIHDATSSHEAEIPVDVPPGGHMSVNPDGSVTVFDADGNPISVVAAPWA
FT                   YDANGNPVPTDYEVRDGRLIQTVYADEATAYPILADPPEKKAKAPTSVASKQVQKNTNT
FT                   AAPKPNSMTSRTSPQKPQNSGNTNSSNTSGATNSGTTAGKCAGITTQGSAPVTKPASPN
FT                   QSPRTTTKPGPKPAPTSQEQATNQLAQAHGEVPPVAPSKPAQPNQSPRTTTSPGPKPTV
FT                   SPRQQAANQLAEAHGDVPAGFTGNVPIPPDPNAPDDRSFPQKVWDTAWGVGESAVDTTV
FT                   DSVGTLGDAWRNFLVVPVHDAAVDPFGFNRGQRAQPSPEHSPAEIAAAAANIVSLIPIV
FT                   GTGGRVGGAAVQEAVEAVLRRGGTAADAEAAGRRAAATAGEAGNRAPSDPTIPVGDRPA
FT                   STPVGGRGDREINVKPGTNRPGIVNGREYTGHAFDRMQERGILPSLVEQAIREGVATPS
FT                   RGNTTVIYDSINNLSVIINETGRVVTTSFGNLSGK"
     MKSVLKLRRS IAGALAAGAL LTGVAGVIGA GIALTAGPAT AGPAEDCAAV RARDHQIYLN        60
     LIASLPPGAP VPPEYINPCL SAPTTTPTAA PTTTVGLPGA QAPGGGPNVG ANAPTNFPAY       120
     NGTPIVPVPG AALPGQPNTP TPSGIENPAG VPVPTTTSGP APTTPQPAGS TAPTAVPDRG       180
     PGPVPSGTPN SAPGQSESNP TVTPSGLDKG DGRDRYLELV LVGAAAFTAG GIGVRGRRSP       240
     FGPRIPLGGR TPESILSQTV GTLASPLMQY VKGGQSKITV TEPGGGRRTF FLIHDATSSH       300
     EAEIPVDVPP GGHMSVNPDG SVTVFDADGN PISVVAAPWA YDANGNPVPT DYEVRDGRLI       360
     QTVYADEATA YPILADPPEK KAKAPTSVAS KQVQKNTNTA APKPNSMTSR TSPQKPQNSG       420
     NTNSSNTSGA TNSGTTAGKC AGITTQGSAP VTKPASPNQS PRTTTKPGPK PAPTSQEQAT       480
     NQLAQAHGEV PPVAPSKPAQ PNQSPRTTTS PGPKPTVSPR QQAANQLAEA HGDVPAGFTG       540
     NVPIPPDPNA PDDRSFPQKV WDTAWGVGES AVDTTVDSVG TLGDAWRNFL VVPVHDAAVD       600
     PFGFNRGQRA QPSPEHSPAE IAAAAANIVS LIPIVGTGGR VGGAAVQEAV EAVLRRGGTA       660
     ADAEAAGRRA AATAGEAGNR APSDPTIPVG DRPASTPVGG RGDREINVKP GTNRPGIVNG       720
     REYTGHAFDR MQERGILPSL VEQAIREGVA TPSRGNTTVI YDSINNLSVI INETGRVVTT       780
     SFGNLSGK                                                                788
//

If you have problems or comments...

PBIL Back to PBIL home page