(data stored in ACNUC1104 zone)

EMBL: AP008957.PE270

AP008957.PE270       Location/Qualifiers
FT   CDS             complement(313662..313841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30978"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM01"
FT                   /protein_id="BAH30978.1"
FT                   /translation="MRNGVLSVHRTLLLDAAVQVVGFTWNHQDVVVFLWDAVGEVVVIG
FT                   DQGKWMATLEGEDV"
     MRNGVLSVHR TLLLDAAVQV VGFTWNHQDV VVFLWDAVGE VVVIGDQGKW MATLEGEDV         59
//

If you have problems or comments...

PBIL Back to PBIL home page