(data stored in ACNUC1104 zone)

EMBL: AP008957.PE273

AP008957.PE273       Location/Qualifiers
FT   CDS             complement(316281..316775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30981"
FT                   /db_xref="InterPro:IPR015068"
FT                   /db_xref="InterPro:IPR035944"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM04"
FT                   /protein_id="BAH30981.1"
FT                   /translation="MELGVHFALSDSVAAELLDARGDDDKLGALVEDIEETGRSEFSCD
FT                   TDKAWDPILCALSSTGYERVSENWPAYGVILGDEDLNTDTDDQLVTYLAPDRVAEVSSY
FT                   LAEITESEFGVRYDAMPLDDRNPEYGSDERGYAWGWLQEVADFFQRAARERRHVVFTVR
FT                   F"
     MELGVHFALS DSVAAELLDA RGDDDKLGAL VEDIEETGRS EFSCDTDKAW DPILCALSST        60
     GYERVSENWP AYGVILGDED LNTDTDDQLV TYLAPDRVAE VSSYLAEITE SEFGVRYDAM       120
     PLDDRNPEYG SDERGYAWGW LQEVADFFQR AARERRHVVF TVRF                        164
//

If you have problems or comments...

PBIL Back to PBIL home page