(data stored in ACNUC1104 zone)

EMBL: AP008957.PE274

AP008957.PE274       Location/Qualifiers
FT   CDS             316906..317877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30982"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM05"
FT                   /protein_id="BAH30982.1"
FT                   /translation="MIPTKRTGLSVVSLVILVVAGLLVAAPASSAAPPPDWKYTMVAFS
FT                   NASDRDMDVYESVDGTGFQLVQQSAYRPPSGLVRDPSIFRNTDGLYYLTYTTGGGANIG
FT                   FARSSDRINWTPLGNYPVPFCCALMPGTGDGTGSASPPGFSGSAGFSDGPSLSPFVTKA
FT                   WAPEWFVDGDRVNVILSMSTGGGFVPYLMTALEPSLRLWSPPVPLAGIGADHIDTTVVK
FT                   VGSTYHAFTKNETKKVVEHAVAPSVTGPYSFVPPGNWGSLVEGPAVVQLPSGDWRIYLD
FT                   AYTEGKYLYSDSTDGLNTWSPVQEVPGVSGTARHLGIMREPA"
     MIPTKRTGLS VVSLVILVVA GLLVAAPASS AAPPPDWKYT MVAFSNASDR DMDVYESVDG        60
     TGFQLVQQSA YRPPSGLVRD PSIFRNTDGL YYLTYTTGGG ANIGFARSSD RINWTPLGNY       120
     PVPFCCALMP GTGDGTGSAS PPGFSGSAGF SDGPSLSPFV TKAWAPEWFV DGDRVNVILS       180
     MSTGGGFVPY LMTALEPSLR LWSPPVPLAG IGADHIDTTV VKVGSTYHAF TKNETKKVVE       240
     HAVAPSVTGP YSFVPPGNWG SLVEGPAVVQ LPSGDWRIYL DAYTEGKYLY SDSTDGLNTW       300
     SPVQEVPGVS GTARHLGIMR EPA                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page