(data stored in ACNUC1104 zone)

EMBL: AP008957.PE279

AP008957.PE279       Location/Qualifiers
FT   CDS             323062..323835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30987"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM10"
FT                   /protein_id="BAH30987.1"
FT                   /translation="MPTSSLRRNPTAGLTVKVIPRKGAPESEAVTAALVARSLRLLRDI
FT                   DPVFDVDLYQTVGDALPDGAGVEQALASNIRQILVPPTEKSIEAALIERRRSPDATGGM
FT                   YPLSLGRHMTLYSPAGDVKVVVSFGGTSGSGAFACAFADESLISLASKLVQGLADIWDS
FT                   RVTVLYRRTESSPQRNVPGDAIVGSCTYFGPELPIKETQLPPSVEAFPYQDGTIVIQKN
FT                   LSTPLTVEDIRSIRAAAGLPTERPEIPLPKGFRRL"
     MPTSSLRRNP TAGLTVKVIP RKGAPESEAV TAALVARSLR LLRDIDPVFD VDLYQTVGDA        60
     LPDGAGVEQA LASNIRQILV PPTEKSIEAA LIERRRSPDA TGGMYPLSLG RHMTLYSPAG       120
     DVKVVVSFGG TSGSGAFACA FADESLISLA SKLVQGLADI WDSRVTVLYR RTESSPQRNV       180
     PGDAIVGSCT YFGPELPIKE TQLPPSVEAF PYQDGTIVIQ KNLSTPLTVE DIRSIRAAAG       240
     LPTERPEIPL PKGFRRL                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page