(data stored in ACNUC1104 zone)

EMBL: AP008957.PE280

AP008957.PE280       Location/Qualifiers
FT   CDS             324921..325538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30988"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM11"
FT                   /protein_id="BAH30988.1"
FT                   /translation="MHRRAKLASVLEGIDGLAMATPRKVRGSAWERVLKAAASNLGPEW
FT                   VVARSGTQGELIHLPVRWWFNSIGLDPKPNREELTFSHVPLMREFTPGTITFRQSSYQP
FT                   GPTDSGPPNMQMDIFDTRGAAEIVRWWALGPSTKFFAAPPLPDSVAAAEQAYADRKEEP
FT                   CRDWMISAGLRVIADTGSPIEVIDSVLWELARRDVGGHVQSF"
     MHRRAKLASV LEGIDGLAMA TPRKVRGSAW ERVLKAAASN LGPEWVVARS GTQGELIHLP        60
     VRWWFNSIGL DPKPNREELT FSHVPLMREF TPGTITFRQS SYQPGPTDSG PPNMQMDIFD       120
     TRGAAEIVRW WALGPSTKFF AAPPLPDSVA AAEQAYADRK EEPCRDWMIS AGLRVIADTG       180
     SPIEVIDSVL WELARRDVGG HVQSF                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page