(data stored in ACNUC1104 zone)

EMBL: AP008957.PE284

AP008957.PE284       Location/Qualifiers
FT   CDS             327337..328206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30992"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM15"
FT                   /protein_id="BAH30992.1"
FT                   /translation="MSFFGRRPTVAGYWGTRVQSSQEVAQTMRAFLDDLEAIDPELALS
FT                   LVSTAEFDKVPADLSVDGLVRIFEHSRSKEMGYSDTPGPGYDIDLSPEDGTARRVGAWV
FT                   GGLETSAPNSVLVSLPTETQLTDSTRRLLDPDIGDAIMRVIVKHWEPERARWSIGDYRH
FT                   LQNRSKGEVEVGWETYFHSGVTFDRSALPQSAVVEELPTGTLIRLGDKPMQVDAADIVA
FT                   VRAALGYPVQAPQWVRSSPLHQMSRNVLTGWPASPFDSIVRWHSEPTCSRGSSIRIQRF
FT                   GGRWSAIC"
     MSFFGRRPTV AGYWGTRVQS SQEVAQTMRA FLDDLEAIDP ELALSLVSTA EFDKVPADLS        60
     VDGLVRIFEH SRSKEMGYSD TPGPGYDIDL SPEDGTARRV GAWVGGLETS APNSVLVSLP       120
     TETQLTDSTR RLLDPDIGDA IMRVIVKHWE PERARWSIGD YRHLQNRSKG EVEVGWETYF       180
     HSGVTFDRSA LPQSAVVEEL PTGTLIRLGD KPMQVDAADI VAVRAALGYP VQAPQWVRSS       240
     PLHQMSRNVL TGWPASPFDS IVRWHSEPTC SRGSSIRIQR FGGRWSAIC                   289
//

If you have problems or comments...

PBIL Back to PBIL home page