(data stored in ACNUC1104 zone)

EMBL: AP008957.PE308

AP008957.PE308       Location/Qualifiers
FT   CDS             complement(349400..349804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31016"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM39"
FT                   /protein_id="BAH31016.1"
FT                   /translation="MGAWGSGPFDNDGAGDLIASIGHGDFTFESVEWAFEDDYLEVDGG
FT                   QIAVALLELVLIVRADRKRDPAAQDLDLDSFTSALTSERLTWLIEMVERTISSTDSELF
FT                   ELWDEQGPEELASWRVPVVDGLEDLRVLSV"
     MGAWGSGPFD NDGAGDLIAS IGHGDFTFES VEWAFEDDYL EVDGGQIAVA LLELVLIVRA        60
     DRKRDPAAQD LDLDSFTSAL TSERLTWLIE MVERTISSTD SELFELWDEQ GPEELASWRV       120
     PVVDGLEDLR VLSV                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page