(data stored in ACNUC1104 zone)

EMBL: AP008957.PE311

AP008957.PE311       Location/Qualifiers
FT   CDS             complement(351881..352750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31019"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM42"
FT                   /protein_id="BAH31019.1"
FT                   /translation="MIIATHNGKFHADDVFGVSLLKQLYPDATVVRSRDESVLDSADIV
FT                   LDVGGRYNPAEGRFDHHQRDAGERSNGILYSAFGLLWQEYGLQFCEGDASVFRRIDSRL
FT                   VEGIDAVDNGQEIYTLNDYGTKPFDLSSVLDLFNPISSTDEEFDTQFELAVVLATQVLI
FT                   RLRAKYAGDAAAEREFTETYEKATDPRFVVLERFVPHGRAASAQPELLFTIFPNTNGGW
FT                   SIQTVKPADSKFGSRKLLPEPWRGLNGSDLAAETGVDSSVFCHKAGFIAAAQTRDGALQ
FT                   LLELALAE"
     MIIATHNGKF HADDVFGVSL LKQLYPDATV VRSRDESVLD SADIVLDVGG RYNPAEGRFD        60
     HHQRDAGERS NGILYSAFGL LWQEYGLQFC EGDASVFRRI DSRLVEGIDA VDNGQEIYTL       120
     NDYGTKPFDL SSVLDLFNPI SSTDEEFDTQ FELAVVLATQ VLIRLRAKYA GDAAAEREFT       180
     ETYEKATDPR FVVLERFVPH GRAASAQPEL LFTIFPNTNG GWSIQTVKPA DSKFGSRKLL       240
     PEPWRGLNGS DLAAETGVDS SVFCHKAGFI AAAQTRDGAL QLLELALAE                   289
//

If you have problems or comments...

PBIL Back to PBIL home page