(data stored in ACNUC1104 zone)

EMBL: AP008957.PE316

AP008957.PE316       Location/Qualifiers
FT   CDS             357904..358938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03160"
FT                   /product="putative iron-siderophore ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31024"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM47"
FT                   /protein_id="BAH31024.1"
FT                   /translation="MRSKRFLAVAAAAVAVALGMTACSSDSSETADGGSAGSGSSSFPV
FT                   TIEHAFGTTTIDAKPERVATVAWANHEVPLALGVVPVGMAAATFGDDNGNGMLPWVEEK
FT                   LDELGAKPPVLFDETDGIDFEAVSDTNPDVILAAYSGLTQEDYDTLSEIAPVVAYPEGP
FT                   WATSWRDVIKFNSMGLGMESEGQELISTIEKEIADEVASHPQLAGKATMFLTHVDTADL
FT                   SQVSFYTANDTRAAFFEDLGLSTPKSVADASTGGEFSKKVSAERVDVFDDVELIVTYGD
FT                   QALVDALKADPLLSQMPAVANNSIVFLNGTGPMGTAANPTPLAISWVLGDYVDLLAGAA
FT                   GKSE"
     MRSKRFLAVA AAAVAVALGM TACSSDSSET ADGGSAGSGS SSFPVTIEHA FGTTTIDAKP        60
     ERVATVAWAN HEVPLALGVV PVGMAAATFG DDNGNGMLPW VEEKLDELGA KPPVLFDETD       120
     GIDFEAVSDT NPDVILAAYS GLTQEDYDTL SEIAPVVAYP EGPWATSWRD VIKFNSMGLG       180
     MESEGQELIS TIEKEIADEV ASHPQLAGKA TMFLTHVDTA DLSQVSFYTA NDTRAAFFED       240
     LGLSTPKSVA DASTGGEFSK KVSAERVDVF DDVELIVTYG DQALVDALKA DPLLSQMPAV       300
     ANNSIVFLNG TGPMGTAANP TPLAISWVLG DYVDLLAGAA GKSE                        344
//

If you have problems or comments...

PBIL Back to PBIL home page