(data stored in ACNUC1104 zone)

EMBL: AP008957.PE317

AP008957.PE317       Location/Qualifiers
FT   CDS             358935..359978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03170"
FT                   /product="putative iron-siderophore ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31025"
FT                   /db_xref="GOA:C0ZM48"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM48"
FT                   /protein_id="BAH31025.1"
FT                   /translation="MTVTSQDSTSGASDTRRPTFGNSLWLIALLVVLAVLMCASIVIGS
FT                   REVDWSDIVAALGGSTDNIGQGAIAKRIPRTVLAIVVGAALGLAGAVMQGITRNPLADT
FT                   GILGVNMGASLAVVIGMAWFGLWTQTSMIWVAVLGAAGAALFVYVVGSLGRGGATPLKL
FT                   ALAGAATSAAFASFITAIMLPRNDIAGNIRSWQIGGVGGASFEVIRQGLPFLIVGFVIC
FT                   LLSARSLNSLALGDEVASGLGERVAVVRAVAALGAVLLCGAATAIAGPIGFVGLVVPHL
FT                   CRLLIGIDNRWLLPFSALTGAGLLVAADILGRIVARPSEIDVGIITALVGAPFFIYIVR
FT                   RQKIREL"
     MTVTSQDSTS GASDTRRPTF GNSLWLIALL VVLAVLMCAS IVIGSREVDW SDIVAALGGS        60
     TDNIGQGAIA KRIPRTVLAI VVGAALGLAG AVMQGITRNP LADTGILGVN MGASLAVVIG       120
     MAWFGLWTQT SMIWVAVLGA AGAALFVYVV GSLGRGGATP LKLALAGAAT SAAFASFITA       180
     IMLPRNDIAG NIRSWQIGGV GGASFEVIRQ GLPFLIVGFV ICLLSARSLN SLALGDEVAS       240
     GLGERVAVVR AVAALGAVLL CGAATAIAGP IGFVGLVVPH LCRLLIGIDN RWLLPFSALT       300
     GAGLLVAADI LGRIVARPSE IDVGIITALV GAPFFIYIVR RQKIREL                     347
//

If you have problems or comments...

PBIL Back to PBIL home page