(data stored in ACNUC1104 zone)

EMBL: AP008957.PE319

AP008957.PE319       Location/Qualifiers
FT   CDS             361024..361839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03190"
FT                   /product="putative iron-siderophore ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31027"
FT                   /db_xref="GOA:C0ZM50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM50"
FT                   /protein_id="BAH31027.1"
FT                   /translation="MTGSHTLTVENLELGYGGRTVVESLDLAVPPGKITTIVGANACGK
FT                   STLLRSMSRLLSPRSGHVLLDGKDVHRLPAKKLARTLGLLPQSPIAPEGIVVADLVGRG
FT                   RHPHQRVLSRWSREDDAAVAEALAATDTTELAERSVDELSGGQRQRVWIAMALAQQTDL
FT                   LLLDEPTTFLDVSHQVEVLDLLTDLNRTRGTTIVMVLHDLNLAARYADYLVAMADRRVY
FT                   AEGDPAEVLTSDNVRTVFGLESRIIPDPISGKPLVLPLGRHHVLDDVLT"
     MTGSHTLTVE NLELGYGGRT VVESLDLAVP PGKITTIVGA NACGKSTLLR SMSRLLSPRS        60
     GHVLLDGKDV HRLPAKKLAR TLGLLPQSPI APEGIVVADL VGRGRHPHQR VLSRWSREDD       120
     AAVAEALAAT DTTELAERSV DELSGGQRQR VWIAMALAQQ TDLLLLDEPT TFLDVSHQVE       180
     VLDLLTDLNR TRGTTIVMVL HDLNLAARYA DYLVAMADRR VYAEGDPAEV LTSDNVRTVF       240
     GLESRIIPDP ISGKPLVLPL GRHHVLDDVL T                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page