(data stored in ACNUC1104 zone)

EMBL: AP008957.PE321

AP008957.PE321       Location/Qualifiers
FT   CDS             362500..363678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03210"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31029"
FT                   /db_xref="GOA:C0ZM52"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM52"
FT                   /protein_id="BAH31029.1"
FT                   /translation="MPSIASSLFWIALIAAIAPIVAGLIPRRLVPEVVLLLVAGAVVGP
FT                   FALNIAADSEAIGILRELGLGMLFLLAGYEIDRQELSGRGGRRALYTWLFCLALAFTVV
FT                   ALLGMRNVISAEAAVAIAMTSTALGTLLPILKDNKLLDTRLGKTVLNHGAVGELGPVVA
FT                   MAVLLSARGAVLSLIVLAVFALIAIVVAVLPGKLIHEGSWTHRLVRAGADTTAQTTVRL
FT                   TVLLLVSLGVLSAVFSLDVILGAFAAGFILRRLMPEGDERLEIKLDGIAFGFLIPIFFI
FT                   TSGMAIDVSAVAASPGILIAFLILIVVVRGVPVFFVTKFEKVEPPFTTRESAQVALYGA
FT                   TGLPMIVAVTGAAVDAHQMSSDNASILVAAGAITVLLLPMLATLLTKKEKVS"
     MPSIASSLFW IALIAAIAPI VAGLIPRRLV PEVVLLLVAG AVVGPFALNI AADSEAIGIL        60
     RELGLGMLFL LAGYEIDRQE LSGRGGRRAL YTWLFCLALA FTVVALLGMR NVISAEAAVA       120
     IAMTSTALGT LLPILKDNKL LDTRLGKTVL NHGAVGELGP VVAMAVLLSA RGAVLSLIVL       180
     AVFALIAIVV AVLPGKLIHE GSWTHRLVRA GADTTAQTTV RLTVLLLVSL GVLSAVFSLD       240
     VILGAFAAGF ILRRLMPEGD ERLEIKLDGI AFGFLIPIFF ITSGMAIDVS AVAASPGILI       300
     AFLILIVVVR GVPVFFVTKF EKVEPPFTTR ESAQVALYGA TGLPMIVAVT GAAVDAHQMS       360
     SDNASILVAA GAITVLLLPM LATLLTKKEK VS                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page