(data stored in ACNUC1104 zone)

EMBL: AP008957.PE327

AP008957.PE327       Location/Qualifiers
FT   CDS             368369..368956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31035"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM58"
FT                   /protein_id="BAH31035.1"
FT                   /translation="MSIQPSGDASWPAVLTWQAHNAPRMESVRVQLNGNRIKASGRIIG
FT                   GACSEHPAFSASYDLVTDEAGITRRLSVRTALAAGERQMSISRDEEGTWMVENGASHQR
FT                   SAFDGALDVDVILSPFFNTLPIRRVGLQNDIEDAEVPVVYVNLLDLRVEGATITYSSGT
FT                   DGISVLSPVSSSTLAVDTEGFVLDYPGLATRI"
     MSIQPSGDAS WPAVLTWQAH NAPRMESVRV QLNGNRIKAS GRIIGGACSE HPAFSASYDL        60
     VTDEAGITRR LSVRTALAAG ERQMSISRDE EGTWMVENGA SHQRSAFDGA LDVDVILSPF       120
     FNTLPIRRVG LQNDIEDAEV PVVYVNLLDL RVEGATITYS SGTDGISVLS PVSSSTLAVD       180
     TEGFVLDYPG LATRI                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page