(data stored in ACNUC1104 zone)

EMBL: AP008957.PE333

AP008957.PE333       Location/Qualifiers
FT   CDS             372115..372798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31041"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM64"
FT                   /protein_id="BAH31041.1"
FT                   /translation="MKKIWWIGGAVVVVVLALLVGPWAYGKFIAEDDAPAAVVSTQGAE
FT                   AASGSIDGQWTVVAGQGDNQTAAGYTVHEILNGSSVTVVGTTGEVSGNAVVEGEKLTSG
FT                   EVTVQVASIKTDSDRRDGQFTGNVMDISTYPTATFTIDSPVDLAAVPTDGTTATVTVSG
FT                   TLTLKGQSKPVSVDMTVLHSGDSLIASGSIPVTWTDFGVEPPSLGFVTVDASGSVDFLV
FT                   SLAAG"
     MKKIWWIGGA VVVVVLALLV GPWAYGKFIA EDDAPAAVVS TQGAEAASGS IDGQWTVVAG        60
     QGDNQTAAGY TVHEILNGSS VTVVGTTGEV SGNAVVEGEK LTSGEVTVQV ASIKTDSDRR       120
     DGQFTGNVMD ISTYPTATFT IDSPVDLAAV PTDGTTATVT VSGTLTLKGQ SKPVSVDMTV       180
     LHSGDSLIAS GSIPVTWTDF GVEPPSLGFV TVDASGSVDF LVSLAAG                     227
//

If you have problems or comments...

PBIL Back to PBIL home page