(data stored in ACNUC1104 zone)

EMBL: AP008957.PE334

AP008957.PE334       Location/Qualifiers
FT   CDS             372919..373272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03340"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31042"
FT                   /db_xref="GOA:C0ZM65"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM65"
FT                   /protein_id="BAH31042.1"
FT                   /translation="MMPRWRPFRTGEDPDPRFTLANERTYLAWIRTATAFVASGVGLEA
FT                   FGGDILNPTVRAGLAALLLVGGALIAITSFVHWISAERALRAERSLPVPLMAPVVGIVL
FT                   VICATVLVVEVVN"
     MMPRWRPFRT GEDPDPRFTL ANERTYLAWI RTATAFVASG VGLEAFGGDI LNPTVRAGLA        60
     ALLLVGGALI AITSFVHWIS AERALRAERS LPVPLMAPVV GIVLVICATV LVVEVVN          117
//

If you have problems or comments...

PBIL Back to PBIL home page