(data stored in ACNUC1104 zone)

EMBL: AP008957.PE335

AP008957.PE335       Location/Qualifiers
FT   CDS             373321..373611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31043"
FT                   /db_xref="GOA:C0ZM66"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM66"
FT                   /protein_id="BAH31043.1"
FT                   /translation="MQSERTSLSFVRTSLSILGLSAACLRWLPPFGSVALIGPSLAAVL
FT                   VVAVTVYERRSRPRRLAQFSAEKATPALGMGAALAVALLLLSATGLWILLT"
     MQSERTSLSF VRTSLSILGL SAACLRWLPP FGSVALIGPS LAAVLVVAVT VYERRSRPRR        60
     LAQFSAEKAT PALGMGAALA VALLLLSATG LWILLT                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page