(data stored in ACNUC1104 zone)

EMBL: AP008957.PE336

AP008957.PE336       Location/Qualifiers
FT   CDS             complement(373577..374518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03360"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31044"
FT                   /db_xref="GOA:C0ZM67"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM67"
FT                   /protein_id="BAH31044.1"
FT                   /translation="MWETLLESWKSLLEPLHDPVTLAIPAFVIFLAIEWFAARALEDHP
FT                   DDADGRARPAEGGYRSVDARTSVLLGLVSIATSTFWKVLALIGYSAIWVYLAPWHLSPT
FT                   AWYTWVILLLGIDVLYYAYHRIAHRVRVIWATHQAHHSSEYFNFSTALRQKWNNSGEII
FT                   MWLPLPFLGIPPWMVFVGFSVSLVYQFFVHTERVGKLWRPIEFIFNTPSHHRVHHGSDA
FT                   EYLDRNYAGILIIWDRMFGTFAAETHRPTYGLTTPVGTYNIWKLQTREYAAIARDWKAS
FT                   KSWRQRAGYVFGPPGWAPKAEVTSAESTAPSH"
     MWETLLESWK SLLEPLHDPV TLAIPAFVIF LAIEWFAARA LEDHPDDADG RARPAEGGYR        60
     SVDARTSVLL GLVSIATSTF WKVLALIGYS AIWVYLAPWH LSPTAWYTWV ILLLGIDVLY       120
     YAYHRIAHRV RVIWATHQAH HSSEYFNFST ALRQKWNNSG EIIMWLPLPF LGIPPWMVFV       180
     GFSVSLVYQF FVHTERVGKL WRPIEFIFNT PSHHRVHHGS DAEYLDRNYA GILIIWDRMF       240
     GTFAAETHRP TYGLTTPVGT YNIWKLQTRE YAAIARDWKA SKSWRQRAGY VFGPPGWAPK       300
     AEVTSAESTA PSH                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page