(data stored in ACNUC1104 zone)

EMBL: AP008957.PE34

AP008957.PE34        Location/Qualifiers
FT   CDS             complement(40421..41839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30742"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH4"
FT                   /protein_id="BAH30742.1"
FT                   /translation="MGIVQRFERKLQGAVGDAFARVFGGGVVPQEVEAALQQEARDRVE
FT                   HLGGGILLAPNNYVITINNSDHEELAADRELTTKAFSRHLQDFIRDQGWQTYGDISVTF
FT                   EPSPTLHTGQFRTRGTVDPDGDAEQASPPSHVPQVSSRPPQRPPQRPAPIVPPVSNPVP
FT                   SQPGAGPMTQNSGYEPSREPAGRQPEPQQPARNGYSHDDGGYAAPQGQEAPYQNGYDRG
FT                   DGYRTGDDQQGYNQQQGGYDQQAYPNQQQPYEQAGYDQQGYDQQGGGYDQQGYQQQPYD
FT                   QQGYGQQAYQGGYDQQGYQQGGYDQQGYQQPYNGQSYDQPGYDQQSYQQGGYDQQAYTQ
FT                   QPYEQAGYEQGGNFEQTQAYPQQGYAQPQGGYAPTAQSLTATLQLEDGSGRHFQLRDGS
FT                   NVIGRGQEAQFRLPDTGVSRRHIDIRWDGRTAMLSDLGSTNGTTVNGAPVQDWQLADGD
FT                   IIRAGHSEILVRIL"
     MGIVQRFERK LQGAVGDAFA RVFGGGVVPQ EVEAALQQEA RDRVEHLGGG ILLAPNNYVI        60
     TINNSDHEEL AADRELTTKA FSRHLQDFIR DQGWQTYGDI SVTFEPSPTL HTGQFRTRGT       120
     VDPDGDAEQA SPPSHVPQVS SRPPQRPPQR PAPIVPPVSN PVPSQPGAGP MTQNSGYEPS       180
     REPAGRQPEP QQPARNGYSH DDGGYAAPQG QEAPYQNGYD RGDGYRTGDD QQGYNQQQGG       240
     YDQQAYPNQQ QPYEQAGYDQ QGYDQQGGGY DQQGYQQQPY DQQGYGQQAY QGGYDQQGYQ       300
     QGGYDQQGYQ QPYNGQSYDQ PGYDQQSYQQ GGYDQQAYTQ QPYEQAGYEQ GGNFEQTQAY       360
     PQQGYAQPQG GYAPTAQSLT ATLQLEDGSG RHFQLRDGSN VIGRGQEAQF RLPDTGVSRR       420
     HIDIRWDGRT AMLSDLGSTN GTTVNGAPVQ DWQLADGDII RAGHSEILVR IL               472
//

If you have problems or comments...

PBIL Back to PBIL home page