(data stored in ACNUC1104 zone)

EMBL: AP008957.PE341

AP008957.PE341       Location/Qualifiers
FT   CDS             379646..381379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03410"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31049"
FT                   /db_xref="GOA:C0ZM72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM72"
FT                   /protein_id="BAH31049.1"
FT                   /translation="MLIRLLRTYLTPYRGELTGVVVLQFISTMAALYLPSLNADIIDNG
FT                   VTKGDTGYILSTGGMMLMVTLTQILCSVGAVFFGARVAMGVGRDLRASVLHQVGTFSAR
FT                   EVGHFGAPSLITRNTNDVQQVQMMVVMSCTILVMAPIMCIGGIIMALRQDLNLSWILGI
FT                   SVPLLVVSMGFLIARMVPGFRVMQGRLDAVNRVLREQITGIRVVRAFVREPYEVERFGD
FT                   ANRELTETALGVGRLMALMFPLVMLISNVTSVAVIWFGGHQINEGSMQIGSLTAMLSYI
FT                   MQILMAVMMATFMAVMLPRASVCAERISEVLDTDSSVIPPENPVLELKDPGVVELRGAQ
FT                   FQFPGAEEPVLRDITFRAEPGKTTAIIGGTGSGKTTLLNLIPRLIDSTSGSVSVGGVDV
FT                   RDIDTELLCSVIGLVPQKPYLFSGTVATNLRYGNPEATDEWLWECLEIAQAADFVRAMP
FT                   EGLDTPVAQGGTTVSGGQRQRLAIARALVRKPQIYLFDDSFSALDLTTDARLRAALRPV
FT                   TQNACIVVVAQRISTIVEADQIIVLDDGAIVGIGTHDELVVSCPTYGEIVASQLAVQDA
FT                   S"
     MLIRLLRTYL TPYRGELTGV VVLQFISTMA ALYLPSLNAD IIDNGVTKGD TGYILSTGGM        60
     MLMVTLTQIL CSVGAVFFGA RVAMGVGRDL RASVLHQVGT FSAREVGHFG APSLITRNTN       120
     DVQQVQMMVV MSCTILVMAP IMCIGGIIMA LRQDLNLSWI LGISVPLLVV SMGFLIARMV       180
     PGFRVMQGRL DAVNRVLREQ ITGIRVVRAF VREPYEVERF GDANRELTET ALGVGRLMAL       240
     MFPLVMLISN VTSVAVIWFG GHQINEGSMQ IGSLTAMLSY IMQILMAVMM ATFMAVMLPR       300
     ASVCAERISE VLDTDSSVIP PENPVLELKD PGVVELRGAQ FQFPGAEEPV LRDITFRAEP       360
     GKTTAIIGGT GSGKTTLLNL IPRLIDSTSG SVSVGGVDVR DIDTELLCSV IGLVPQKPYL       420
     FSGTVATNLR YGNPEATDEW LWECLEIAQA ADFVRAMPEG LDTPVAQGGT TVSGGQRQRL       480
     AIARALVRKP QIYLFDDSFS ALDLTTDARL RAALRPVTQN ACIVVVAQRI STIVEADQII       540
     VLDDGAIVGI GTHDELVVSC PTYGEIVASQ LAVQDAS                                577
//

If you have problems or comments...

PBIL Back to PBIL home page