(data stored in ACNUC1104 zone)

EMBL: AP008957.PE358

AP008957.PE358       Location/Qualifiers
FT   CDS             397172..397480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31066"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM89"
FT                   /protein_id="BAH31066.1"
FT                   /translation="MGTLFALTLPGLLVLLVLFAFAETLWNRLTGGRALPWTRGRTTRP
FT                   VSAAGFEEVAALFQGSKHHEFEQRQSALMHREDGTDGDPPWVSVDPEANKVVLRRRS"
     MGTLFALTLP GLLVLLVLFA FAETLWNRLT GGRALPWTRG RTTRPVSAAG FEEVAALFQG        60
     SKHHEFEQRQ SALMHREDGT DGDPPWVSVD PEANKVVLRR RS                          102
//

If you have problems or comments...

PBIL Back to PBIL home page