(data stored in ACNUC1104 zone)

EMBL: AP008957.PE360

AP008957.PE360       Location/Qualifiers
FT   CDS             398782..399135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31068"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM91"
FT                   /protein_id="BAH31068.1"
FT                   /translation="MIGAAAPRTDDQWTRMICSSWEAPEHVGGHVYATAAANDPVPMIG
FT                   DVFGGLSHGANPANDLPLIGFGATVIESAPGTGIDAGLLGELPSPVAHSEYWERTNPAL
FT                   AGMGHVIAGLGAP"
     MIGAAAPRTD DQWTRMICSS WEAPEHVGGH VYATAAANDP VPMIGDVFGG LSHGANPAND        60
     LPLIGFGATV IESAPGTGID AGLLGELPSP VAHSEYWERT NPALAGMGHV IAGLGAP          117
//

If you have problems or comments...

PBIL Back to PBIL home page