(data stored in ACNUC1104 zone)

EMBL: AP008957.PE364

AP008957.PE364       Location/Qualifiers
FT   CDS             403337..403918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31072"
FT                   /db_xref="GOA:C0ZN20"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR017658"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN20"
FT                   /protein_id="BAH31072.1"
FT                   /translation="MALQLNLVGDPEADALLAEDPLALLIGMLLDQQVPMETAFLGPKK
FT                   LADRLSGIDVRRIADMDTDEFIAICAEPPAVHRFPKSMGERIQLMCQFIVENYDGDTAA
FT                   IWTSGNPDGKEVLKRLKALPGYGDQKARIFLALLGKQIGVEPKGWRQAAGDYGLEGSRR
FT                   SIADVVDEQSLLEVREFKKAAKAAAKADKK"
     MALQLNLVGD PEADALLAED PLALLIGMLL DQQVPMETAF LGPKKLADRL SGIDVRRIAD        60
     MDTDEFIAIC AEPPAVHRFP KSMGERIQLM CQFIVENYDG DTAAIWTSGN PDGKEVLKRL       120
     KALPGYGDQK ARIFLALLGK QIGVEPKGWR QAAGDYGLEG SRRSIADVVD EQSLLEVREF       180
     KKAAKAAAKA DKK                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page